PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G08860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 320aa    MW: 36200.9 Da    PI: 9.8141
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G08860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.67.7e-104183348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd  l ++ ++ G+++W+++a++     +   c++rw+++l
  LPERR06G08860.1 41 AWTPEEDAVLERLATENGSRHWRRVASRRR---CHAACRDRWRDHL 83
                     7**************************986...9*********986 PP

2Myb_DNA-binding23.21.6e-0791133346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+ +d+ l+++  +l gg+Wk I+r +  gR+   ++ rw+ 
  LPERR06G08860.1  91 PFTPADDDELARLYLRLDGGRWKDISRAVH-GRSTRAVRCRWRE 133
                      89****************************.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9683487IPR017930Myb domain
SMARTSM007170.00143885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-134193IPR009057Homeodomain-like
SuperFamilySSF466895.79E-1441107IPR009057Homeodomain-like
CDDcd001679.11E-64183No hitNo description
PfamPF002492.3E-84183IPR001005SANT/Myb domain
SMARTSM007170.01688137IPR001005SANT/Myb domain
SuperFamilySSF466892.47E-790153IPR009057Homeodomain-like
CDDcd001670.0015591134No hitNo description
PROSITE profilePS500906.79591135IPR017877Myb-like domain
PfamPF139218.4E-692137No hitNo description
Gene3DG3DSA:1.10.10.606.0E-894134IPR009057Homeodomain-like
SMARTSM007170.0027200291IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-9204286IPR009057Homeodomain-like
SuperFamilySSF466899.93E-13226290IPR009057Homeodomain-like
PROSITE profilePS512947.131238293IPR017930Myb domain
CDDcd001670.00281245288No hitNo description
PfamPF139212.3E-6246291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEIEPSAAAV QVQAASTAAV ASSPSAPPRV RCVARQRLPP AWTPEEDAVL ERLATENGSR  60
HWRRVASRRR CHAACRDRWR DHLARDVFHR PFTPADDDEL ARLYLRLDGG RWKDISRAVH  120
GRSTRAVRCR WREIRSSDEF LKKLWSPFSS MLSPAEKDVA RMEMELSSAA APASDQPEST  180
TVVSSSSSAA CVRCVTRLRL PPAWTPVEDA VLEHLVTENG SPPLASRRCR DRWRDHLARD  240
VFHRPFTAAD DDELARLYLS VDGARWKDIS KAVHGRSTRA VRRRWREICS SDELLRKLWN  300
PLSTMMSPAG QDTVMDAGVH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642261.11e-52PREDICTED: transcription factor MYB44-like
TrEMBLA0A0D9WP130.0A0A0D9WP13_9ORYZ; Uncharacterized protein
STRINGORGLA06G0089700.18e-53(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83601346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.14e-11myb domain protein r1